SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01036560001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01036560001
Domain Number 1 Region: 69-339
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.34e-47
Family Mammalian PLC 0.042
Further Details:      
 
Weak hits

Sequence:  GSVIVT01036560001
Domain Number - Region: 20-72
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0439
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01036560001
Sequence length 364
Sequence
MGLGANLFFILLSFFFSVATACTNGKCRLLDECSTDEDCGAGLYCFSCPQGFSGSRCVRS
SITDQFKVLNNSLPFNKYAFLTTHNSYAIDGEQSHTGVPRLTFTNQEDSVTQQLNNGARG
LMLDTYDFEGDVWLCHSFGGECHDYTAFGPAIDTLREVEAFLSANPVEIVTLILEDYVKA
PNGLTKVFTDAGLMKYWFPVTSMPQNGEDWPLVSDMVAQNQRLIVFTSIKSKQESEGIAY
QWNYMVENQYGDGGMHRGNCPARGESSPLNDGAKSLVLVNYFKTIPLKQPTCQQNSGDLI
NMLQTCYGAAGNRWANFVAVDYYKRSEGGGSFQAIDTMNAKLLCGCDDIHACVALSTSGA
CTPS
Download sequence
Identical sequences D7SMP5
XP_002277997.1.54126 GSVIVT01036560001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]