SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01037112001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01037112001
Domain Number 1 Region: 280-398
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.02e-29
Family Protein kinases, catalytic subunit 0.0016
Further Details:      
 
Domain Number 2 Region: 664-848
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.71e-27
Family Protein kinases, catalytic subunit 0.0015
Further Details:      
 
Domain Number 3 Region: 173-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 4 Region: 131-212,527-582
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000133
Family Growth factor receptor domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01037112001
Sequence length 898
Sequence
MLLIWPWIEEGISKTPAFSLAESNCSYQCGKVMIPYPFGIGNAECAKDKNFLLKCNNGQP
FLLQNIPVLGISLAQGTVTVSLQSASERNKKHTLTDKIFYGGFNLEGSPFMLSNSNKFIV
DLDWVVGEKTCKEAQANCGKNTVCSDSTNGPGYRCFCKPGFSGNPYRPNGCEDIDECSEP
NIYQCEGICRNTVGNYSCRCPFGMHGEGKVACRGHHTATVFLGIGLSLGFLLALSGLFRL
YLLVHEQNSIKLKRKFFKRNGGLLLEQQISSDKGKLEKIKNFTSEELEKATDHYNDNRIL
GQGGQGIVYKAMLPDGNLVAVKKSEMMDEGQIEHFVNEVVILSQINHRHVVKLLGCCLET
EVPLLVYEYVSNGTLSDHIHAQLEEAPMKWADRTRIATLAGSPFTFFHNRNKFVVLGCNI
TALIDNNREYRRACLSFCRGYPPSAAPGFCTTSLPKQLKTLNITLFSIDPSSDSNHKFCL
HAFVAAKSTYSISEINLSKHPVTTQVTLQWVVGEEKCEASGNRSETYACGKNTECQSSTN
GPGYRCICKQGFQGNPYLPGGCQDIDECDDPSGYPCDGFCQNTAGDYTCRRSDESEVNSR
RHGVAILASAIILSIGFLLLIAGIYWLNALVKKRKIIKLKKKLFKRNGGLLLQQQISSDK
GKLEKLKIFSSEELEKATDYYNENRILGKGGQVIVYKGMLPDGSVVAVKKSKKMDKAQIE
RFANEVVILSQINHRNVVKLLGCCLETEVPLLVYEFVSNGTLSNHIHDQMEESPMKLSDR
LRPISGLRSEDMGLAAHFICSAKKNRLFDVLDPQVVMEGEKEELVILANLAMRCLKLSGS
KRPTMKEVSWELENLKKLQKHLPVELDHQEDDYYFAESSRSLEPGDELELDMHPRSTE
Download sequence
Identical sequences GSVIVT01037112001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]