SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01037136001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01037136001
Domain Number 1 Region: 114-254
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-42
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 522-596
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000981
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01037136001
Sequence length 643
Sequence
MAALNYQLNGSKLGTVNDALYKELWHACAGPLVNVPREQERVYYFPQGHMEQLEASMHQG
LDQKMPSFNLPSKILCKVVNVHLRAEPETDEVYAQVTLLPEPDQSEITSPDPPLPEPQSC
TVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSQNPPWQELVAKDLHGNEWHFRHI
FRGQPRRHLLTTGWSVFVSSKRLAAGDAFIFLRGENGELRVGVRRLMRQLNNVPPSVISS
HSMHLGVLATASHAITTGTLFSVFYKPRASPSEFIVSVNKYLEARNHKVSVGMRFKMRFE
GDEAPERRFSGTIVGVGDTGSSGWTDSEWRSLKVQWDEPSSILRPERVSPWELEPLVTET
PLTAQPMQRSKRPRSPVLSSPTPGLSAFAVKTNSHSFTVNYSSTAVSNNSAYWPQQSEPV
PELFTPVPNKEYGKKKPENGNGYRLFGIQLVDNSNVEETLPVTTISSGAGEDQPVVCLDA
DSDHQSQRSNINQSKTPTVGSDPEKSCLGSSLLQSRQIRSCTKVHMQGMAVGRAVDLTQF
SSYKELLSKLEEMFDIKGELCGPTKKWQVVYTDDEDDMMMVGDDPWHEFCSMVRKIFIYT
VEEVKELSPKAKLPLKGEFKPGKPDSKTTIGTEDHSSMVGSGF
Download sequence
Identical sequences GSVIVT01037136001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]