SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01037845001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01037845001
Domain Number 1 Region: 35-143
Classification Level Classification E-value
Superfamily PA domain 0.0000000353
Family PA domain 0.01
Further Details:      
 
Weak hits

Sequence:  GSVIVT01037845001
Domain Number - Region: 516-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 300-400
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0277
Family Thioltransferase 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01037845001
Sequence length 631
Sequence
MGLLRSVLALCLGFVVVCLVVVPPAVAKFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQY
GGSMAGTVVYPKENTKGCKGFDEYGISFKSKIGALPTFVVVDRGDCFFALKVWNAQNAGA
SAVLVADNIEEPLITMDSPEEDGSSSKYIENITIPSALIEKSFGEKLKKAITSGEMVNVN
LDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMEFVKDFKGAAQILEKGGFTQFTPHYI
TWYCPQAFTVSKQCKSQCINHGRYCAPDPEQDFSKGYEGKDVVLENLRQLCVFRVANESK
RPWVWWDYVTDFQIRCPMRKKKYNKECAETVIASLGLDSKKIEKCMGDSNADSDNPLLKE
EQDAQVGKGTRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPDVCLSGDVET
NECLDNNGGCWQDKTANITACKDTFRGRVCECPLVDGVKFKGDGYSSCEASGPGRCKINN
GGCWHDSQDGQSFSACLDIDGGKCECPPGFKGDGVKSCKDVDECKEKKACQCPECSCKNT
WGSYECTCSGDLLYIRDHDTCISKRATEVKSAWAAVWVILIGLAMAGTGAYLVYKYRIRS
YMDSEIRAIMAQYMPLDSQTEVPNHVSEDHA
Download sequence
Identical sequences D7SXR1
GSVIVT01037845001 29760.GSVIVG00001461001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]