SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01038316001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01038316001
Domain Number 1 Region: 150-193
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000978
Family Protein kinases, catalytic subunit 0.019
Further Details:      
 
Weak hits

Sequence:  GSVIVT01038316001
Domain Number - Region: 36-62
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0196
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01038316001
Sequence length 198
Sequence
MHSGGDPIVLNSNQAQSVHISESPSSIKEDSSLGPSDCQAICWNNCSCTACNTIYTNGTG
CRFWSTKFTQTYAGDANREALYVLSSSRVTGNSWWIWVIIAGVVLVVLLLMGFLYYLRRK
SKGERKMEEAMLHELATSNSFSDSKDVDHDGKRAHDLKLFSFDSIVVASNNFSSENKLGE
GGFGPVYKVIIISLSHSM
Download sequence
Identical sequences GSVIVT01038316001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]