SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01038330001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01038330001
Domain Number 1 Region: 106-153
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000109
Family alpha-D-mannose-specific plant lectins 0.028
Further Details:      
 
Weak hits

Sequence:  GSVIVT01038330001
Domain Number - Region: 171-211
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0353
Family Pan module (APPLE domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01038330001
Sequence length 246
Sequence
MLTLLSTLNCWSPPKIYAHTFQAISLISLHGHEKLGIGEMESSMCLSSAILSLCLSCMWL
GVVPSISGAQTDTIKPGEELQFSKKLLVSAKGTFTLGFFSLESGSYLGIWYTTDDYHKKV
WVANRDKAISGTDANLTLDADGKLMITHSGGDPIVLNSNQAQSVLISGSPSSIKEKSSLG
LRDCKALCWNDCSCTAYNSLYTNGTGCRFWSTKFALVLKDDANQEELYVLSSSRVTGKSL
SVFLHS
Download sequence
Identical sequences GSVIVT01038330001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]