SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01038348001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01038348001
Domain Number 1 Region: 244-387
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.21e-40
Family Protein kinases, catalytic subunit 0.00068
Further Details:      
 
Weak hits

Sequence:  GSVIVT01038348001
Domain Number - Region: 113-154
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0353
Family Pan module (APPLE domain) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01038348001
Sequence length 464
Sequence
MKRRGGTYWSSGTLKDRSFEFIPLLNNIYSFNSVSNANEIYFSYSVPEGVGSDWVLTSEG
GLFDTNRSVFMQDDQCDRDKEYPGCAVQNPPTCRTRKDGFVKESVLISGSPSSIKENSSL
GLGDCQAICWNNCSCTAYNSIHTNGTGCRFWSTKFAQAYKDDGNQEERYVLSSSRVTGSS
WRIWVTIAGVVLVVLLLLGSLYFLTRKFRGEREMEEAMLPELATSNSFSDSKDVEHDGTR
GAHDLKLFSFDSIVAATNYFSSENKLGEGGFGPVYKGKLLEGHEIAVKRLSRGSSQGLVE
FKNEIRLIAKLQHMNLVRLLGCCIQGEEKMLIYEFMPNKSLDFFLFDPDRRKILDWKRRH
NIIEGVAQGLLYLHKYSRLRIIHRDLKWLHGTRNKSFHHNHGAFAINLAGYAWELWKEGT
SLELNQVGFPQGNLFQSTTEADLVSFETWFERIAWGSICLFFPQ
Download sequence
Identical sequences GSVIVT01038348001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]