SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01038562001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSVIVT01038562001
Domain Number - Region: 3-28
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0785
Family Hairpin loop containing domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01038562001
Sequence length 270
Sequence
MASTTKCRVLCTRVLQIFCRAFEFPQQNGLVYPMDRVFEYDPSLFSYQTNYNLPNFVDLR
ELEDHFLFLDQNLPSCNGVSIHDHPDDFDHYLEVGSEEHLTQLPSGNDSEDRLKIGGGFS
DLQSVIHGGFSGSWKHEEGTQQSSRSKTAALEMDDIKQYFNVPITRAAKELKVGLTVLKK
RCRELNITRWPHRKIKSLKALITNAKVLNKTRELGLTEEIEMLEEHRRMLEKQPEMELTE
KAKKLRQACFKANYKRKRALQAPFTQISYE
Download sequence
Identical sequences E0CV58
GSVIVT01038562001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]