SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01038682001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01038682001
Domain Number 1 Region: 95-194
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000804
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01038682001
Sequence length 194
Sequence
MERKLKLDGSPSGSVANQETSKPSMGKGKGNEGKTMKKNVRFNLPASDLKPSMEKRDQVD
EDSSKAKKVEKMGGGSSLCLWLPMSRSRSSSKDRTPTLIFSKRLTFGDLLTGKLRVPSLV
FLPKKHEGKHGRMMVPFVDSKGEFWELEATPQWFSLNLDKFVKAHGLKCDDVILFYEDGP
NSRYYVIDYERTGC
Download sequence
Identical sequences E0CVF8
XP_019081575.1.54126 GSVIVT01038682001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]