SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01008466001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01008466001
Domain Number 1 Region: 331-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  GSVIVT01008466001
Domain Number - Region: 291-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000897
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01008466001
Sequence length 574
Sequence
MAVKIHHLLFSVEGEGCTSLDQSFSEYLSRRDWGILPLEPFHYQKGARAMALRLILLLQL
AVLVWELEVAAELALPGCASHCGNISIPYPFGTTPECYLNQDFFINCNSTHQAFLTDSNI
DVLSISVSGQLRVLSYVARDCYNKSGQRVANNDPWMTLAKFPISHTRNKFMTVGCDTYAF
IKGSSGKKYKTGCLSLCESKDSVINGSCSGIGCCQTTIPVNVTSIDISVDSYDSYTGVWE
FNPCGFAFVAEDGYFNFSSADLLDLQNKTKVPTVLDWTIGDEKCDQAKENGTSYACKDNS
YCYDPDNGPGYRCNCSEGYEGNPYLLNGCKDIDECEVDNPCNVTHTCRNLPGSFSCFCPA
GYEGDGFKIGTGCSPMPSSESKFPLVNVALGISISLLVLLLVSSWLYWGFRKRKLIKLKE
KFFEQNGGIMLQQLLSKHEGFAEATKIFTTEDLKKATNNYDERRLLGYDRLFEILDDRVL
NEGNTKHLKEVAILAKRCLMVKGEERPTMKEVAMELEGLRILETHPWVNNNSNPEETEYL
IGQSQDAYKGDNSSNIIGYDSIRDQVMVDFNGGR
Download sequence
Identical sequences GSVIVT01008466001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]