SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01008777001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01008777001
Domain Number 1 Region: 691-753
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000202
Family Protein kinases, catalytic subunit 0.0088
Further Details:      
 
Domain Number 2 Region: 267-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000385
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 579-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000458
Family EGF-type module 0.02
Further Details:      
 
Domain Number 4 Region: 937-972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000029
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  GSVIVT01008777001
Domain Number - Region: 530-614
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000345
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 230-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0012
Family EGF-type module 0.072
Further Details:      
 
Domain Number - Region: 1050-1124
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0176
Family Protein kinases, catalytic subunit 0.02
Further Details:      
 
Domain Number - Region: 319-371
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0241
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Domain Number - Region: 757-797
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0497
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01008777001
Sequence length 1170
Sequence
MAEAAVAQAKPGCPDRCGNVSIPYPFGTKKDCNHSQHFLLHCNDSVMPPKLTLGMNLHVV
SISLGELKILNFLGRDCYNSYGGLVYENDPWLRLGSGYTISGKRNKFIAVGCDTYAIVRA
YKGEERYTTGCMSVCDSITNVKSGSCSGIGCCETSIPEGTTNFTVKLSSYNNHRSVWAFN
PCSYAFVVEETHFKFSSNQFRDLNNTENLPVVLDWRIGKERCKAARKTETYACKGKSECY
EPDDWSGYLCKCLDGYHGNPYLPDGCQDINECDDPSLNKCVKKGRCKNTPGNYTCSCPKG
YHGDGRQDGDRCNLDHLQVIPVVLDDNLFQVLDKHIVNEGNIEQLREAANLAKRCLRLKG
DERPTMKEVSMELERIKMMEKQAWIDSKEKEQLHGESSQAYDNDCSFGFTSASFNSLRFF
AVGCDTYALLQGYQGGDLYTTGCMSICSSEKQVQDGSCSGAGCCQVSFPEGLDDTTLTLS
SYFNHTKVHDFNPCSYAFIAEESAFNFSSKNLTNLQDMEKLPRVVDWSIGNETCQVAKTN
PSSYACKENSTCSEPSGRSGYLCKCFDGYHGNPYLDGCQDIDECENSSLNKCVEKARCKN
IPGNYTCSCRKGYHGDGREDGDGCNPNMLQVIQIALGVSIGLISLLMGSSWLYWGLKKRK
FIKLKKKFFEQNGGLMLRQQLSSQEGSNETVKIFSAEELEKATDKYAENKIIGQGGYGTV
YKGTLTNGRIVAIKKSKMVDKILDERIVNEENIEQLKETANLAKKCLKLKGDERPTMKEV
AMKLERMRMVEMHPWTDPEENEYLLGESSHTVDNGCSIGSTNTAYDSLKGHIMLPNKDKN
ESKGVFLSIPISFKGLLKYNVTVHTYHNHTFTWSFNPCSYTFLVEEGSFNFSTADLIDLQ
KIDKVSTVLDWAVGNQTCEEAQKNSTSYACKENSNYVDECEDPKLNDCTDRCTNTIGGYN
CSCPWGHHGHGRGKDGCTADQLLFIKITIGVGVGLIVLLTSSSWLYWILKKRKFLKVKEK
YFRQNGGLILEQQLSKREGSNERSKIFTAEELEKATNKYNESKIIGRGGFGIDNISHEVN
GEELNEVALLAKRCLELKGEDRPTMKEVAMELEGMRKMKMHPWIGELNSEETIHLLDESS
NTHQYDTNGNVTTVYDSIRDHITLPLHNAR
Download sequence
Identical sequences GSVIVT01008777001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]