SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01009806001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01009806001
Domain Number 1 Region: 185-251
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.17e-22
Family DNA-binding domain from rap30 0.0023
Further Details:      
 
Domain Number 2 Region: 10-119
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 6.02e-17
Family Rap30/74 interaction domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01009806001
Sequence length 259
Sequence
MEEEQGNSSSSNLETGKAERSVWLMKCPLAVSKSWQSHSSSESQPVAKVVLSLDPLRSED
PSALEFTMEMTGTGAPNMPKSYSLNMFKDFVPMCVFSETNQGRVAMEGKVEHKFDMKPHN
ENIEEYGKLCRERTNKSMIKNRQIQVIDNDRGVHMRPMPGMVGLIASNSKDKKKTAPVKG
SDMKRTRRDRGELEDIMFKLFERQPNWALKQLVQETDQPAQFLKEILNELCVYNKRGTNQ
GTYELKPEYKKSAEDTGAE
Download sequence
Identical sequences E0CPG6
29760.GSVIVG00014517001 XP_010664754.1.54126 GSVIVT01009806001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]