SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01011947001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01011947001
Domain Number 1 Region: 93-162
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-20
Family B3 DNA binding domain 0.0000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01011947001
Sequence length 228
Sequence
MDGSCIDESTTSDSISTSLPALSALPATKSPESLCRVGSGTSVILDSESRRSCQGLRHRG
AEVPWPRRAKLRVGREWEEEPSRRPHDSIRTGTTSKGVLLNFEDMGGKVWRFRYSYWNSS
QSYVLTKGWSRFVKEKNLKAGDIVSFQRSTGGDKQLYIDWKARNGPTNQINPVEPVEMVR
LFGVNIFKVPVNSSVVVANNGSWTGKRMIEMELLSFECSKKQRVIGAV
Download sequence
Identical sequences GSVIVT01011947001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]