SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014445001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014445001
Domain Number 1 Region: 61-208
Classification Level Classification E-value
Superfamily PapD-like 3.14e-32
Family MSP-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014445001
Sequence length 264
Sequence
MGIADRRKPSSEGKLWRLCPFWQSGNGSPSSSSTQNFQQHKIRGRRHVDDTDTRSSPSKV
SSVARSFLPTRRRLRLDPANNLYFPYEPGKQVKSAVRMKNTSRSHVAFKFQTTAPKSCYM
RPPGGILAPGESIIATVFKFMEHPENNEKNEKQLDQKSNVKFKIMSLKVKAGMDYVPELF
DEQKEKVSVERILHVVFLDVERPSPALEKLKRQLAEAEAAVEARKKPPPEIGPRVIGEGL
VIDEWKERREKYLAQQQVEAVDSV
Download sequence
Identical sequences A5ARH9
29760.GSVIVG00027583001 XP_002284424.1.54126 GSVIVT01014445001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]