SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01021673001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01021673001
Domain Number 1 Region: 432-662
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-71
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 325-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000468
Family EGF-type module 0.0074
Further Details:      
 
Weak hits

Sequence:  GSVIVT01021673001
Domain Number - Region: 289-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01021673001
Sequence length 702
Sequence
MITNHLNLVKKMLNVIPRKMVMQMIQVLAFTILISIISLLFSLKETAASMAKPGCPETCG
NVSIVYPFGIGKGCYLDKRFEITCNNSSLPHPLFHVDEENEAEVLYMSLEYMRIRDWASP
DCYANYTSEGQSYAQFPVAPMEPFSYSHTENKFIGIGCDIFAYIGYSNTTNSTNKSYISG
CVSVCNGQGWSWLDTNYSCSGIGCCQNTFPEDLSIFEIRIGNMSTWADGGDWPSNQCSLV
LIAENNFSEFHQFDVSFSNVNKTYFYPSVLNWAIGNKSCHEAQKRGDYACGSNSRCVNSK
KGSGYTCQCNSGYRGNPYLPDGCGDVDECMESNNTLCQKGAVCTNTNGSYYCDCPPGYYR
DDDKPEYECVRHKGKHNPALLVSSGIAVTLVLLILLAISFWLNKKLEKRKKSKLKQMSLK
KNGGLLLQRQISSSSIGSSVEKTKLYTIEESEKATDNFNAGRVLGKGGHGKVYKGMLLDG
SIVAIKKSIVVDERQVVEFINEVFILSQINHRHIVKLLGCCLESEVPLLVYEYVSNDTLS
HHLHNEDHASTLSWEERLRIADEIAGALAYLHSYASTAILHRDIKSRNILLDENFRAVVS
DFGLSRSIAHEKTHLSTLVQGTFGYLDPEYFRSGQFTDKSDVYGFGMILAELLTGEKVIL
KKIDNEKNIISCFTFSTGYNSYTQWIPIRSTIGGLTIVMQIN
Download sequence
Identical sequences D7TKL1
GSVIVT01021673001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]