SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01021685001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01021685001
Domain Number 1 Region: 100-378
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-72
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 613-758
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-36
Family Protein kinases, catalytic subunit 0.0014
Further Details:      
 
Domain Number 3 Region: 958-997
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family EGF-type module 0.025
Further Details:      
 
Domain Number 4 Region: 5-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000503
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 503-542
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  GSVIVT01021685001
Domain Number - Region: 1080-1138
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0212
Family Protein kinases, catalytic subunit 0.014
Further Details:      
 
Domain Number - Region: 481-512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0935
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 921-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0954
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01021685001
Sequence length 1253
Sequence
MFSKDINECEDPNKIFCHEIALCTNVPGSYSCTCPTSYHGDGKKQGTGCIRAGISVVSLI
LIATGLRLYRGLKEREKKKIKQKFFKKNGGLLLQQQISSSKESVEKTKLYSVEELERATD
GFNSSRVIGKGGLGTVYKGMLSDGSIVAIKKSNTVDEKQLDQFVNEVFILSQINHRHIVR
LLGCCLETEVPLLVYEYVSNGTLFHHLHDEGHASTLSWKDRLRIGSEIAGALAYLHSYAS
IAICHRDIKSRNILLDENLRAVVSDFGLSRSIPLDKTHLTALVQGTFGYLDPDYFHSGQF
TDKSDVYAFGVVLAELLTGEQAISSDRSEQGLANHFRSAMKQNRLFDILDNQVVNEGQKE
EIFAVAKLTKRCLKLNGKKSTTYETGCASLCPDNNITVGFSSSACTGIGCCRTDLQTDMT
WFYLRIRSINMLTPAWNYEPCSLAFIAERNFSISENFDLSSKFDRNLYFVPAILDWSVGN
GQGYKCNCSEGYQGNAYLANGCQDINECEDPNKIFCHEIALCTNVPGSYSCTCPTGYHGD
GKKQGTGCIRGKHKHLLALVFSLGAGISVVSLILIATGLRLYRGLKEREKKKIKQKFFKK
NGGLLLQQQISSSKESVEKTKLYSVEELERATDGFNSSRVIGKGGLGTVYKGMLSDGSIV
AIKKSNTVDEKQLDQFVNEVFILSQINHRHIVRLLGCCLETEGHASTLSWKDRLRIGSEI
AGALAYLHSYASIAICHRDIKSRNILLHATYKLRINDIAYRSCFNNQSGKTDSSYVSYNR
THHFSYSFTHNKFIAIGCDIFAYITGHNSTAYATGCASLCNTGNDITAGFSSSACSGIGC
CRTYLQTDIASFYLRIRSINMITPTWSSEPCGLAFIAERNFSIREHFNLSSKFDKNLYFV
PAVLDWSVGEVSCHEAIRRKNYACGQNTYCNNSIQGRGYNCHCLNGYQGNPYLANGCQDI
NECNDPKQNACHKIAICSNIPGSYSCTCPAGYHGDGKTNGTGCIPGKRKHLLALVFSLGV
GITVVPLILIATGLWLYRRLKEREKKKIKQEFFKKNGGLLLQQQISSSKESVEKTKLSEQ
GLANHFRSAMKQNRLFEILDNQVVNEGQKEEIFAVAKLAKRCLKLNGKKRPTMKQIDIDL
QQLGRFQEQLSFQKTKIQEPSLQQQTCQDYFTVTGSMFIYAIDFWNNDVMNGSELCFTFF
NLFQYGTHIIRVQLGLRLLDNQSRSTFIYTSSSFSKPNNSIQSKLPKLFFFKS
Download sequence
Identical sequences D7TKL9
GSVIVT01021685001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]