SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01021686001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01021686001
Domain Number 1 Region: 437-724
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-77
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 328-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000143
Family EGF-type module 0.021
Further Details:      
 
Domain Number 3 Region: 769-807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000628
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  GSVIVT01021686001
Domain Number - Region: 255-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.075
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01021686001
Sequence length 893
Sequence
MLLQLLVSVHLITIIIFFVFIPQEAGASLTKPGCPEKCGNVTIPYPFGMGKGCYLHRDFE
ITCNMSSNPPLPLLQEVQLLQISEDNLRINDIAYRSCFNNQSGKTDSSYILYNRTHHFSY
SYTHNTFVAIGCDIFAYITGYNSTAYATGCASLCNTDNDIAAGFSSSACSGIGCCRTYLQ
TDIAHFYLRIRSINMITPTWSSEPCGLAFIAERNFSTLEHFNLSSKFDKKLYFVPAVLDW
SVGEVSCHEAIRRKNYACGQNTYCNNSIQGRGYNCHCLNGYQGNPYLANGCQGTVLLLFN
ILYLLFCHSHKLMNFLLIFFFSFVLSKDINECNDPNQNVCHKIALCSNIPGSYSCNCPSG
YHGDGRKHGTGCIRGKRKHLLLLVFSLGVGIIVVPLILISTGLRLYRGVEEREKKKIKQE
FFKKNGGLLLQQQISSSKESVEKTKLYSVEELERATDGFNSGRVIGKGGLGTVYKGMLSN
GSIVAIKKSNTVDEKELDQFVNEVFILSQINHRHIVRLLGCCLETEVPLLIYEYVSNGTL
FHHLHDEGHASTLSWKNRLRIGSEIAGALAYLHSYASIAICHRDIKSSNILLDENLRAVV
SDFGLSRSIPLDKTHLTALVQGTFGYLDPDYFHSGQFTDKSDVYAFGVVLAELLTGEQAI
SSDRSEQGLANHFRSAMKQNRLFEILDNQVVNEGQKEEIFAIAKLAKRCLKLNGKKRPTM
KQVDIDLQQLGRFQGLSLQKTWIQEPSLQQQTCEDYCTVSETSHSYTFDINECNDPNKNF
CHKMAVCSNIPGSYSCTCPAGYHGDGKKNGTGCIRGKHGHLLPLVFSLGVGITVVPLILI
ATGLRLYRGLEKREKKKKNRTSSRRTAVCYCNSKFLQAKKVNTVWQLKVSVEY
Download sequence
Identical sequences GSVIVT01021686001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]