SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01026123001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01026123001
Domain Number 1 Region: 257-439
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.65e-30
Family Protein kinases, catalytic subunit 0.0042
Further Details:      
 
Domain Number 2 Region: 151-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000737
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  GSVIVT01026123001
Domain Number - Region: 108-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00365
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01026123001
Sequence length 491
Sequence
MMVRLMLVGLLLLASAAAAAATVGQAKEGCLDKCGDVSIPYPFGTNEEQCYLSPYFLVTC
NHSSNPPKLLLGKPSPEGNNVQVLDISLEGELLILNYVSHDCQRDIQDENSQTNYACKGN
SSCNKRKTGWGYLCNCSEGYQGNPYLESGCQDINECENSILNKCENPETCVNTQGNYTCS
CPMWYQGDGKIDGQRCIPNRLQMIHAAMGIGIALLVLLVSSTWLFWALKKRRFIKLKKKY
FQQNGGSELRQLSRQGSTARIKIFTFEELEKATKKYDESNIIGRGGFGTVYKGTLTDVPL
LVYEFINNGTLSDHIHNENKASAIMWETRLRIAIQTAEALYYLHSVASTPIIHRDGTPGY
LDPESMQTNQVTEKSDRILTMFFLFALKDDSLFQVLEDCIVNNGNHMQILKVAQLAKRCL
SIKGEDRPTMKEVVLELEIVRMIGENAEQNPEDNAYLLRKSSAHCYLGGAELSTATHSMV
GNFLLPVSDAR
Download sequence
Identical sequences GSVIVT01026123001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]