SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01027463001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01027463001
Domain Number 1 Region: 92-199
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.66e-30
Family B3 DNA binding domain 0.0000139
Further Details:      
 
Domain Number 2 Region: 20-54
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000785
Family GCC-box binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01027463001
Sequence length 375
Sequence
MRRTRQFMGVAPEPYRYEQQQQQRAWLGTSEPEEEAARSYDRAALELGGPDGVTDSSRKL
EFVNLSLRNNEDGDGGGGCSSSVGGGVCVEREHMFDKVVTPSDVGKLNRLVIPKQHAEKY
FPLDSSASDKGLLLNFEDRDGKPWRFRYSYWNSSQSYVMTKGWSRFVKEKKLDAGDIVSF
ERGVGESGKDRLYIDWRRRPDAPDPTSLSHLHLPTQLPFSQSVRWGRLYSLPQSPNTLGG
GYHDYNAVTSGSGSLYYLSSSSSSHQIGAVQQGGDAPMVINSVPVVHGKTTAKRLRLFGV
NMECSTPDDHPECNILPSTAIPHVTMASLSPHLPSSSLPPLQLRLFNGSPLQAVNVLAAA
SLGTLAGGAQKVTEL
Download sequence
Identical sequences GSVIVT01027463001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]