SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01030002001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01030002001
Domain Number 1 Region: 43-184
Classification Level Classification E-value
Superfamily PapD-like 5.23e-34
Family MSP-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01030002001
Sequence length 240
Sequence
MPFWQSNNASSSSSTSSSLQSVHQQSQSHQVLQSSNAVSFVTKSLLPTRRRLHLDPPNKL
YFPYEPGKQVRSAISIKNISRSHLAFKFQTTAPKSCYMRPPGGILAPGESLIATVFKFVE
HPENNEKPAVDQKSKVKFKIMSLKVKGEMDYVPELFDEQKDQVAEEQILRVVFLDTERPS
PPLEKLKRQLAEAEAALEARKKPPEDTGPRIVGEGLVIDEWKERRERYLARQQVEGIDSV
Download sequence
Identical sequences A5BZK7
GSVIVT01030002001 29760.GSVIVG00029184001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]