SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSVIVT01031853001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01031853001
Domain Number 1 Region: 660-759
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.02e-24
Family B3 DNA binding domain 0.00072
Further Details:      
 
Domain Number 2 Region: 251-350
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-20
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 3 Region: 58-143
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.16e-18
Family B3 DNA binding domain 0.001
Further Details:      
 
Domain Number 4 Region: 348-430
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-18
Family B3 DNA binding domain 0.0011
Further Details:      
 
Domain Number 5 Region: 821-921
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-18
Family B3 DNA binding domain 0.0073
Further Details:      
 
Domain Number 6 Region: 556-628
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000235
Family B3 DNA binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01031853001
Sequence length 1085
Sequence
MKISYTAENGFLIFGLGEIDLVRIRNMKNRTRLKNQIMVSKQPCNMGLQHQKSGGHEFSW
DRLQIPTAFVKHFNGFVPEKAILRDSVGRVWHVEVGQIGKNVYFLKGWQQFLTDNLVEEG
DLFVFQYDGSYIFDFKLYGTTGCQKKDSEVNVDVNKKKFFVKGEEDVEEVERNEEEEEEE
EEEEEPQSKSSNKGVVVFKRKYSGRGGYKQTAIKKTRSAYKETSHTKSKYKKACTGNVEV
DNALDFKSIVKPENPCFITKIRPGRRSKLYVPVDILKDHNIALPPRVLLCDPHGRSWPGD
VTIWKDGRTWIGGWRAFCKWNHVGENDSCICEFVQESGCRGDLIVVHIHRRIPTAFVEHF
NGFMPEKAILRDFVGRVWHVEVGPIGKNVYFLNGWQQFLTENSVEEGDFLVFRYAGNCIF
DFKLLGRTECEKKDTKVVDMDIYKKDFCVKEKDVEEAEGEEEEEEEEEKEEEEEEEEEDE
EEEKMEEDDEEEERKLQPKSPNMKMVVKHKYSSRGCPAIDRKNYCGYKQSAVKKTRGVYK
ETAHTKSNYKKASSSQAEYVPADILQDFNIALPPRVLLRDLHGRSWPGDVSVWKDGRTWI
GGWQAFCKSNHLDENDCCIYEFVLENGHHGDFIVLHIHRAQPKISPRGFFLLQNEMSSPQ
EECPEFFKVCLPECSSDKLLIPTAFREHFNGFVPHKAILRDPVGRVWQVELSKIGKDVYF
QKGWQKFVTDNFVEMEDFLVFRYDGGYIFDFKLFRNTGCEKKGSEEINVGIYKRCFFGYK
QTAIKKSRVASEESNCTKRKYKEASAVQVEENIAFEIESIVNPQNPYFETKVRPARRSKL
YVPLDVLRDHNIKLPPKMTLRDPLGRLWIGKVAVWKDGRTWIGWKPFCKWNNVGENDTCI
CEFVQESGHEGYLLVVHILRAQPSRRAPKCKCRAESGEEMAEPMGQSFSRNKLISSACQP
TILLSPYPTSPISLLTKCHLLPSHHLCTSIFEQSSSTSSHQIVGKIAMATASATLSPSTF
SAAAIAGLGRTSQRRKTNVHFIGGLNSFDGLKAYNSVASLGLPVCTEQSFAKIVGSLKYS
GLRQS
Download sequence
Identical sequences GSVIVT01031853001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]