SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000140 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000140
Domain Number 1 Region: 316-554
Classification Level Classification E-value
Superfamily SIS domain 3.05e-59
Family double-SIS domain 0.0000357
Further Details:      
 
Domain Number 2 Region: 1-173
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.46e-37
Family Class II glutamine amidotransferases 0.0000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000140   Gene: ENSVPAG00000000150   Transcript: ENSVPAT00000000150
Sequence length 677
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_166:143710:212281:-1 gene:ENSVPAG00000000150 transcript:ENSVPAT00000000150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFAYMNYRVPRTRKEIFETLIRGLQRLEYRGYDSAGVAIDGNNNEVKERHIQLVKKRGNV
KALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKGNEFVVIHNGII
TNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXAIIEHTNRVVFLEDDDIAAVADGKLSIHRVKRSASDDP
SRAIQTLQMELQQIMKDNFSAFMRKEIEQPESVFNTMRGRVNETHTVLLGGLKDHLKEIR
RCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFISQSG
ETADTLLALRYCKDRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFIS
LVMFGLMMSEDRISLQNRRREIIHGLRSLPELIKEVLSLDEKIHDLALELYTQRSLLVMG
RGYNYATCLEGALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSVPAP00000000140 ENSVPAP00000000140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]