SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000307 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000307
Domain Number 1 Region: 149-556
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.86e-81
Family Amylase, catalytic domain 0.00015
Further Details:      
 
Domain Number 2 Region: 34-147
Classification Level Classification E-value
Superfamily E set domains 8.05e-20
Family E-set domains of sugar-utilizing enzymes 0.01
Further Details:      
 
Domain Number 3 Region: 558-602
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000698
Family alpha-Amylases, C-terminal beta-sheet domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000307   Gene: ENSVPAG00000000331   Transcript: ENSVPAT00000000331
Sequence length 660
Comment pep:known_by_projection scaffold:vicPac1:scaffold_515:62452:309890:1 gene:ENSVPAG00000000331 transcript:ENSVPAT00000000331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PYLKPFAPDFQRRYKHFNQTLNNIGENEGGIDKFSRGYESFGVHRCADGGVYCKEWAPGA
EGVFLTGDFNDWNPFSYPYKKMDFGKWELYIPPKQNRSVVIPHGSKLKVVIRSRSGEILY
RISPWAKYVTREGGNVNYDWTHWDPEHPYKFKHPKPKKPRGLRIYESHVGISSYEGKIAS
YKHFTCNVLPRIKDLGYNCIQLMAIMEHAYYASFGYQVTSFFAASSRYGTPEELKELVDT
AHSMGITVLLDVVHSHASKNSEDGLNMFDGTESCYFHYGPRGHHTLWDSRLFIYSSWEVL
RFLLSNIRWWLEEYSFDGFRFDGVTSMLYHHHGIGQSFGDYHEYFGLQVDEDALTYVMTA
NHWVHIMYPDDVSGMPALCSPISQGGVGFDYRLAMAIPDKWIQLLKEFKDEDWNMGNIVY
TLTNRRYLEKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKM
IRLITHALGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNN
FDRDMNKLEERCGWLSAPQAHVSEKHETNKVIVFERAGLLFVFNFHPSKSYTDYRVGTSL
LGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLLVYIPNRVALILQNVDLPN
Download sequence
Identical sequences ENSVPAP00000000307 ENSVPAP00000000307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]