SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000315 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000315
Domain Number 1 Region: 584-884
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-83
Family Protein kinases, catalytic subunit 0.00000000105
Further Details:      
 
Domain Number 2 Region: 2-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.57e-72
Family Ephrin receptor ligand binding domain 0.000000967
Further Details:      
 
Domain Number 3 Region: 295-500
Classification Level Classification E-value
Superfamily Fibronectin type III 8.83e-41
Family Fibronectin type III 0.0000728
Further Details:      
 
Domain Number 4 Region: 878-948
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000163
Family SAM (sterile alpha motif) domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000000315
Domain Number - Region: 241-281,329-349
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0612
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000315   Gene: ENSVPAG00000000339   Transcript: ENSVPAT00000000339
Sequence length 953
Comment pep:known_by_projection scaffold:vicPac1:scaffold_505:231577:573945:1 gene:ENSVPAG00000000339 transcript:ENSVPAT00000000339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRN
SAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADE
SFTQMDLGDRILKLNTEVREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLA
MFPDTVPMDSQSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXCRPGFYKALDGNTKCAKCPPHSSTPEDGSVNCRCENNYFRADKDPPSMACTRPPSAPR
NVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNVKQCEPCSPNVRFLPRQFGLT
NTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVMTIKKDRTSR
SSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTTYVFQIR
ARTAAGYGTNSRKFEFETSPDSFSISGENSQVVMIAISAAVAIILLTVVTYVLIGRFCGY
KSKHGADEKRLHFGNGHLKLPGLRTYVDPHTYEDPTQAVHEFAKELDATNISIDKVVGAG
EFGEVCSGRLKLPSKKEISVAIKTLKVGYTDKQRRDFLGEASIMGQFDHPNIIRLEGVVT
KSKPVMIITEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAAR
NILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSY
GIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPK
FEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSSVDIPTFRTTGDWLNGVRTAQCKE
IFTGVEYSSCDTIAKISTDDMKKVGVTVVGPQKKIISSIKALETQSKNSPVPV
Download sequence
Identical sequences ENSVPAP00000000315 ENSVPAP00000000315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]