SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000443 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000443
Domain Number 1 Region: 288-457
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.07e-32
Family Myeloperoxidase-like 0.0044
Further Details:      
 
Domain Number 2 Region: 25-102
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.00000000000000377
Family Myeloperoxidase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000443   Gene: ENSVPAG00000000473   Transcript: ENSVPAT00000000473
Sequence length 1006
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1674:102136:122210:1 gene:ENSVPAG00000000473 transcript:ENSVPAT00000000473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFCLALAWTLLVGPWIPLGAQNPISWEVQRFDGWYNNLMEHRWGSKGSRLQRLVPASYA
DGVYQPLGEPHLPNPRDLSNTAMRGPAGRASLRNRTVLGVFFXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNIAMYEWLPSFL
QQTPPAYTGYRPFLDPSISPEFLAASEQFFSTMVPPGVYMRNASCHFQGVINRNSSVSRA
LRVCNSYWSREHPNLRRAEDVDALLLGMASQIAEQEDHVVVEDVRDFWHGPLKFSRTDHL
ASCLQRGRDLGLPSYTQARAALGLAPVTRWQDVNPALSRSDSTXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXDPCPQPRQLSTEGLPACAPPVMRDYFEGSGFGFGITIA
TLCCFPLVSLLSAWIVAQLRRRNFKRLQGRNRQSVMSQKLMGGMKALEWQGHKEPCRPVL
VHLQPGQIHVMDGRLSVLRTVQLQPPQQVSLILSSNRRRRALLLKIPKEYDLVLLFNLEE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLRSFIEISNNCLSKAQLAEVV
ESMFRESGFQDKQELTWEDFHFMLRDHDSELRFTQLCVKXXXXXXXXXXXXXXXXXXXXX
XXXPSPRMRARCPPSNVDVEVELTPWRLQCPTDTDPPQEIRRRFGK
Download sequence
Identical sequences ENSVPAP00000000443 ENSVPAP00000000443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]