SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000452 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000452
Domain Number 1 Region: 169-326
Classification Level Classification E-value
Superfamily E set domains 4.67e-62
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000224
Further Details:      
 
Domain Number 2 Region: 60-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.12e-23
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000452   Gene: ENSVPAG00000000483   Transcript: ENSVPAT00000000483
Sequence length 413
Comment pep:known_by_projection scaffold:vicPac1:scaffold_3803:8850:108972:-1 gene:ENSVPAG00000000483 transcript:ENSVPAT00000000483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVLEGDSMDQDVESPVTIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGN
VRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGDMDHIEDPSW
TPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSIVNAFMVGCM
FVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSE
GEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILE
GMVEATGMTCQARSSYITSEILWGYRIPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXELASRAELPSWSVSSKLNQHAELETEEEEKNPEEQTERNGDVANLENESKV
Download sequence
Identical sequences ENSVPAP00000000452 ENSVPAP00000000452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]