SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000461 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000461
Domain Number 1 Region: 7-188
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.06e-74
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000466
Further Details:      
 
Domain Number 2 Region: 183-306
Classification Level Classification E-value
Superfamily E set domains 4.6e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000461   Gene: ENSVPAG00000000493   Transcript: ENSVPAT00000000493
Sequence length 589
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1069:510728:537279:1 gene:ENSVPAG00000000493 transcript:ENSVPAT00000000493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGGYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCKDGYYEAEFGQKRRPLFFQNLGIRCVKKKEVKEAII
SRIRAGINPFSVPEQQLLDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPLVSNPIYDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTSLLF
QKLWQDCVTFERPRPSPLGSTGEGRFIKKESNLFSHGAVLTETSRPVSSQAESYYSSSVS
ISSALSHHASPIPPVVPQPSSSWSSVAHSTSRSVNTNSLSSFSTGALSSNSQVISPFLDM
SVSDLNASSTCIYNNTNDIGRMEASSVSPADLYGISDASMLPNCPVNMIPPSNDTMRETD
NPRLVSMNLENPSCNSFLDPRDLRQLHQMSSSSMSAVASSSTTAFVAQSEAFEGSDFTCA
DNSMINESGPSNGTNPNSHSFVQNSQYSGIGTMQNEQLSDSFALGFFPR
Download sequence
Identical sequences ENSVPAP00000000461 ENSVPAP00000000461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]