SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000504 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000504
Domain Number 1 Region: 2973-3173
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000134
Family Galacturonase 0.058
Further Details:      
 
Domain Number 2 Region: 1014-1101
Classification Level Classification E-value
Superfamily E set domains 0.00000000153
Family E-set domains of sugar-utilizing enzymes 0.026
Further Details:      
 
Domain Number 3 Region: 1195-1255
Classification Level Classification E-value
Superfamily E set domains 0.0000000216
Family E-set domains of sugar-utilizing enzymes 0.03
Further Details:      
 
Domain Number 4 Region: 937-1000
Classification Level Classification E-value
Superfamily E set domains 0.000000154
Family E-set domains of sugar-utilizing enzymes 0.061
Further Details:      
 
Domain Number 5 Region: 1567-1643
Classification Level Classification E-value
Superfamily E set domains 0.0000153
Family E-set domains of sugar-utilizing enzymes 0.048
Further Details:      
 
Domain Number 6 Region: 1378-1441
Classification Level Classification E-value
Superfamily E set domains 0.0000675
Family E-set domains of sugar-utilizing enzymes 0.058
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000000504
Domain Number - Region: 1480-1556
Classification Level Classification E-value
Superfamily E set domains 0.00056
Family Other IPT/TIG domains 0.036
Further Details:      
 
Domain Number - Region: 258-289
Classification Level Classification E-value
Superfamily E set domains 0.00122
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.065
Further Details:      
 
Domain Number - Region: 1711-1766
Classification Level Classification E-value
Superfamily E set domains 0.00224
Family E-set domains of sugar-utilizing enzymes 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000504   Gene: ENSVPAG00000000543   Transcript: ENSVPAT00000000544
Sequence length 4054
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2748:63668:484314:-1 gene:ENSVPAG00000000543 transcript:ENSVPAT00000000544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGWLVPLTSIEVLLLAVSSLSIHVEPKEGSLAGGTWLTVIFDDFEASLLYPANGSQLEI
HLVNVAAPALPSVPCDLAPVFLALPAVMCRTRPLLSEAHEGLYYLEVRSGAQVVGSPRPG
PQDSGTFKFSRAQTPIVYQVHPPSGVPXXXXXXXXXXXXXXXXXXXXXXXXXXXPLILEA
HGDQWVTPCSLVNRKTGRCYPIQEDHGLGTLQCRVEGNYIGSQNVSFSVFNRGKSTVHKN
AWLVSAKQDLFLYQTYSEILSVFPATGSLGGGTDITITGDFFDNPVRVTIAXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWEFACTD
LRGTCVHDPACLQPPPANCPVLVHGIDLLPVSPGTGAFYVDEVIIADTNLTXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVPSEGAEGGSGSVQATTWRLQ
RTSPPLGGHFRIQLSDTVIPGVPVHISASHLQKLLQNNADDFTSRYLNVSDFTVTEDLKS
CYEHVWTLSWSTQVGDLPNFIRVSDENLTGVNPVVTTRVVYDGGVFLGPIFGDMLVTANE
HTQVVVRVNDVPPHCSSSCSFQYLEGSTPRVXXXXXXXXDIDLLVYITGSSFSDDSQALQ
VTVNQTHCKVISSNQTNVVCRTGLLPVGVHRISVLVRPSGLAISASGGGLFLNVEPRLDA
VEPSRAADTGGLWATIRGSGLEDVSLVLFGSQPCAVNVTTSHSRRIQCKVPPRGKDGPIV
NVTVIRGDHSVVLPTAFIYVSSLNPVITSLSRNRSNVAXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDLHIQYLTEVFSIQP
CCGSLLGGTILSLSGVGFSRDPALVWVLVGNRSCDIVNSTETNIWCETPPAPLLPGAPAP
VEVWAGRRPSPSGPPPSLVGEGFTFMYEAAATPVVTAMRGEITNHGLRLSVVGRNLSNSV
VLLGGLSCDLETQSSGTHMILSGCDFPLPSLEAGIYPLRVRQKHMGFANMSAVPQQFVVT
PRITAVFPTRGSACGGTVVTVRGLVLNSSRRSVQVDLSGPFICAMLSLGDQAVICQVALV
GDSLPGASFNLNVTLNVTVLVNGLPSECQGNCTLFLREEMTPVVDALTINSSGSLTMVLI
RGRRLSTAADAPVVLVADRLPCFVTFFNMSHVTCWIKDLAPGPHYLSVFHARYGYACFGN
VSRDFHVLPQVFHYFPKNFSIHGGSLLTMEGSALKGRNTTLVYVGRQACLMVNLGSEVFR
CMVPAGIGSVALDIKVDGLSYQMGIMVYSDFTMLSFQTDIYFVIGAARDIYGHWVGVFCQ
TQCVRPSAGRYQVRYDRTGGWSSLMFTSRVTVTAVTENFGCLGGRLVHVFGAGFSPGNIS
AAVCGAACQVLANATVSAFSCLVPPLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKVERDEVLIYNSSCTITM
ETEAKMECETCNQPITAKITEIRKSRGQNTQGNFSLXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLPEVVVTHLRAAARAQDTVLALED
AVDWHPGEEVVILSRAGAQGAKPTEETVIVDTVHHADLHLRSPLRYSHNATENWVAGERR
VLNVMVLLLSRSVTIQGNVTDERGKLLASCPGAEASEGNLQDCLYSKSEKVLGSRDLGAR
VIIQSFPEEPSQVQLQGVQFRDLGQAFRKHGSSLTLAGALRXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXLGHALLVGASPEIRHIPWEVIPGGENDWSEQGNVIRNNVIIDVS
GAEGLSSPEMLAPSGIYIRDPTNVVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFRSSNLHLKNFQVYACRDFG
IDVLESDANTSVTDSLLLGHFAHEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXGFTVKTSQLKFTNSPNAVAFPFPHAAVLEDLDGSLTGKNGRHVLASMETL
SASCLVSDSFSQLVHGSVCEENVRFHQMSIGLANAPKLSYDLTITDSGNKTTTVSYVHDT
LSNPNGWMALLLDQETYSLRFESPWTNNSSLQYSATFDSFAPGNYLLLVHRDMWSYPDIL
LKCGSRVGRALPSLPSPDQDQGCDWFFDSQLRQLTYLVSGEGQVQVSLQVREGVSPTISA
STLAPESILKWSLPEAWEGVEEGWGGHNGTIPGPGDDVLILPNRTVLVDTDLPWLRGLYV
TGTLEFPVDRSNVLSVACMVIAGGELRVGTLENPLEKEKKLLILLRASEGVFCDRFNGIR
VDPGTIGVFGKVQLHSAYPKKSWTRLGADIASGNDRIIVEDTVDWRPHDKIVLSSSSYEP
HEAEVLTVKEVKGHHIRIHERLKHRHIGSVHVMEDGRSVRLAAEVGLLTRNIQIQPDTAC
GGRLLVGSFRKSSMEEISGVLQLFNVEIRNLGSPLYSSIDLTNVSAGSWIISSTLHQSCG
GGIRAAASRGIILNDNLVFGTVGHGIDLEGQDCSLSNNLVVLMTQSAWSTVWVAGIKVNQ
AKDVHLHGNVVAGSERLGFHVRGHRCSSPEALWSDNVAHSSLHGLHLYQECGPDNCTSVS
GFLAFKNFDYGAMLRVQNSVEVENITLVDNTVGLWAAVYVSSAPQCYIRNIQIVLRNSVL
VATSSSFDCIQDRVKPRSANVTSADRAPSNPRGGRVGLLWPVFTSEPHQWPRESWHKVRS
GRSISGIIKLQDVTFSSFLKSCYSDDLDVCILPNAENTGIVHPITAERTRMRKIKDKNKF
YFPPLQTRKDLETLICSEPDCESPRRYLFKDLDGRALGLPPPVSVFPKTEGEWTGSFFNT
GTFREEQKCTYRPPIQGYICKQTDHVILILESDEATWTTQTFYPVVSVTSGFVDTFSSVN
ANTACSTSGSVSSFYSILPTKEITKVCFVDRTPQALRFFLLGNKSTSKLLLAVFYHELQS
PRVFLGERFIPPTLLQSTSSLLNESIGSNYFSIPDNLLYVVLQGEEPVEIRSGVSIHLAL
TVMFSALEEGWEIMILERLTDFLQVSQDQIRILHDMPGDEATLKAIADSRAKRKRTCPTV
TCASLDRVGQRRPLMMEESSYRVLPPTTVETLSKVVVIEIGDLPTVQSPGLTPSLSSNKL
QSLAHQVISAQQTGVLESVLNTTIGALLVTQSKGVTGYGNTSSFKPGNLIYVRPSALSVL
VQPSDGEVGKELGVQPELVFLDKQNRRVESLGPPSEPWAVSVSLEGAPDSVLRGCTRAET
QDGYVSFSNLAVLISGSNWHFIFTVTSPPGVNFTARSRPFAVLAATPSERSTMLLAASLC
SVVSWLALCCLVCCWFKKSKNRKIKSEEISESQTNDQKNHIHVTSKCQGPQIEMEKEGAR
MAEDLRMKVLRGRLNQLPHQSLNGVSRRKGSRLVVWEEGGRQAEAAAPAPGVAGVTAHGN
PCAPGSPAQQVYLQETGSWKEAQEQLLRYQLAGQDQLLLLCRDLRQERQRLQGQSRLDKD
TVSLGLSQEKPASCSTTEAFCLHPVHPEAVQEHL
Download sequence
Identical sequences ENSVPAP00000000504 ENSVPAP00000000504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]