SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000583 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000000583
Domain Number - Region: 40-152
Classification Level Classification E-value
Superfamily E set domains 0.0392
Family Arrestin/Vps26-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000583   Gene: ENSVPAG00000000630   Transcript: ENSVPAT00000000630
Sequence length 326
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2488:269067:290088:1 gene:ENSVPAG00000000630 transcript:ENSVPAT00000000630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFLGGFFGPICEIDVVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGK
RLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESY
IGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYN
KSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAPV
KGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEK
LRKQRTNFHQRFESPESQASAEQPEM
Download sequence
Identical sequences L8HZY6
ENSVPAP00000000583 ENSTBEP00000013317 ENSTBEP00000013317 ENSVPAP00000000583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]