SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000607 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000607
Domain Number 1 Region: 15-319,423-464
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.69e-69
Family FAD-linked reductases, N-terminal domain 0.00000000675
Further Details:      
 
Domain Number 2 Region: 299-409
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.64e-32
Family L-aminoacid/polyamine oxidase 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000607   Gene: ENSVPAG00000000657   Transcript: ENSVPAT00000000657
Sequence length 527
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3305:49468:112593:1 gene:ENSVPAG00000000657 transcript:ENSVPAT00000000657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENQDKADNAGQVFDVVVIGGGISGLSAAKLLNEHGVNVLVLEARDRVGGRTYTVRNENV
DYVDVGGAYVGPTQNRILRLSKELGLETYKINVNERLVQYVKGRTYPFRGAFPPVWNPIA
YLDYNNLWRTMDNMGKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTARQFASLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMQLLGDRVKL
RCPVTFVDQSGDNITIRTLNHELYECRYVISAIPPTLTAKIHFRPQLPSERNQLIQRLPM
GAIIKCMMYYREAFWKKKDYCACMIIEDEEAPFSITLNETKSDGTLPAIMGFILARKADR
LAKVHKEIRKRKICELYAKVLGSQEALQPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAGREILNALGKVSKQDIWVKEPESSD
VPAIEITHTFWERNLPSVSGLLKIIGFSTSITALCFLAYRFRQLSRS
Download sequence
Identical sequences ENSVPAP00000000607 ENSVPAP00000000607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]