SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000755 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000755
Domain Number 1 Region: 57-140
Classification Level Classification E-value
Superfamily E set domains 7e-26
Family ML domain 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000755   Gene: ENSVPAG00000000816   Transcript: ENSVPAT00000000815
Sequence length 144
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1670:590157:597699:-1 gene:ENSVPAG00000000816 transcript:ENSVPAT00000000815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLASSASALAEPVHFKDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQSQ
SSKAVVHGIVLGVSIPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQW
ELQDDKDQRLFCWQIPVQIVPHLH
Download sequence
Identical sequences ENSVPAP00000000755 ENSVPAP00000000755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]