SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000859 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000859
Domain Number 1 Region: 947-1059
Classification Level Classification E-value
Superfamily E set domains 1.6e-35
Family Filamin repeat (rod domain) 0.00000277
Further Details:      
 
Domain Number 2 Region: 1061-1169
Classification Level Classification E-value
Superfamily E set domains 1.93e-33
Family Filamin repeat (rod domain) 0.00000335
Further Details:      
 
Domain Number 3 Region: 680-787
Classification Level Classification E-value
Superfamily E set domains 1.59e-31
Family Filamin repeat (rod domain) 0.00000122
Further Details:      
 
Domain Number 4 Region: 1136-1251
Classification Level Classification E-value
Superfamily E set domains 5.34e-31
Family Filamin repeat (rod domain) 0.0000281
Further Details:      
 
Domain Number 5 Region: 858-968
Classification Level Classification E-value
Superfamily E set domains 4.94e-30
Family Filamin repeat (rod domain) 0.00000118
Further Details:      
 
Domain Number 6 Region: 122-239
Classification Level Classification E-value
Superfamily E set domains 8.28e-29
Family Filamin repeat (rod domain) 0.00063
Further Details:      
 
Domain Number 7 Region: 1459-1554
Classification Level Classification E-value
Superfamily E set domains 1.73e-28
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 8 Region: 412-536
Classification Level Classification E-value
Superfamily E set domains 1.13e-27
Family Filamin repeat (rod domain) 0.00093
Further Details:      
 
Domain Number 9 Region: 335-445
Classification Level Classification E-value
Superfamily E set domains 1.33e-27
Family Filamin repeat (rod domain) 0.00069
Further Details:      
 
Domain Number 10 Region: 1639-1734
Classification Level Classification E-value
Superfamily E set domains 1.8e-26
Family Filamin repeat (rod domain) 0.00000323
Further Details:      
 
Domain Number 11 Region: 1234-1349
Classification Level Classification E-value
Superfamily E set domains 2.07e-25
Family Filamin repeat (rod domain) 0.00000722
Further Details:      
 
Domain Number 12 Region: 229-331
Classification Level Classification E-value
Superfamily E set domains 4.74e-24
Family Filamin repeat (rod domain) 0.00021
Further Details:      
 
Domain Number 13 Region: 2019-2110
Classification Level Classification E-value
Superfamily E set domains 5.94e-24
Family Filamin repeat (rod domain) 0.0000146
Further Details:      
 
Domain Number 14 Region: 1926-2017
Classification Level Classification E-value
Superfamily E set domains 5.94e-24
Family Filamin repeat (rod domain) 0.0000166
Further Details:      
 
Domain Number 15 Region: 1744-1830
Classification Level Classification E-value
Superfamily E set domains 2.34e-20
Family Filamin repeat (rod domain) 0.00000873
Further Details:      
 
Domain Number 16 Region: 2148-2235
Classification Level Classification E-value
Superfamily E set domains 1.2e-19
Family Filamin repeat (rod domain) 0.0000437
Further Details:      
 
Domain Number 17 Region: 65-144
Classification Level Classification E-value
Superfamily E set domains 6.67e-19
Family Filamin repeat (rod domain) 0.0023
Further Details:      
 
Domain Number 18 Region: 610-697
Classification Level Classification E-value
Superfamily E set domains 8.41e-18
Family Filamin repeat (rod domain) 0.0019
Further Details:      
 
Domain Number 19 Region: 1397-1473
Classification Level Classification E-value
Superfamily E set domains 2.47e-16
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 
Domain Number 20 Region: 1835-1910
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000014
Family Filamin repeat (rod domain) 0.0000585
Further Details:      
 
Domain Number 21 Region: 1550-1637
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000667
Family Filamin repeat (rod domain) 0.00000587
Further Details:      
 
Domain Number 22 Region: 805-882
Classification Level Classification E-value
Superfamily E set domains 0.000000000000627
Family Filamin repeat (rod domain) 0.00013
Further Details:      
 
Domain Number 23 Region: 556-614
Classification Level Classification E-value
Superfamily E set domains 0.0000000000034
Family Filamin repeat (rod domain) 0.0026
Further Details:      
 
Domain Number 24 Region: 2-64
Classification Level Classification E-value
Superfamily E set domains 0.0000000000801
Family Filamin repeat (rod domain) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000859   Gene: ENSVPAG00000000930   Transcript: ENSVPAT00000000931
Sequence length 2236
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1528:82073:170955:1 gene:ENSVPAG00000000930 transcript:ENSVPAT00000000931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEPNGNMVKQPAKFTVDTISAGQGDLMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKV
TGLHKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKPLQPGPHVV
KVSFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGIRIRETADFKVDTKAAGSGELG
VTVKGPKGLEELVKQKGFLDGVYAFEYYPSTPGKYSIAITWGGHHIPKSPFEVQVGPEAG
MQKVRAWGPGLHGGVVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYDDQNDGSCDVKY
WPKEPGEYAVHIMCDDEDIKDSPYMAFIHPASEDCNPDLVQAYGPGLEKSGCIVNNLAEF
TVDPKDAGKAPLKIFAQDGEGQPIDIQMKSRMDGTYACSYTPVKAIKHTIAVVWGGVNIP
HSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTDAGEGDVSVGIKCDARVL
SEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKTLTTSQEIPASPFRVKVDPSHDASXX
XXXXXXXXXXLPGDVVKDLDIIDNYDYSHTIKYTPTQQGNMQVLVTYGGDPIPKSPFTVG
VAAPLDLSRIKINGLENRVEVGKDQEFAIDTRGAGGQGKLDVTILSPSRKVVPCLVAPVA
GRESSTAKFIPREEGLYAVDVTYDGHPVPGTPYTVEASLPPDPTKVKAHGPGLEGGLVGK
PAEFTIDTKGAGTGGLGLTVERPCEAQIECSDNGDGTCSVSYLPTKPGEYFVDILFEEHI
PGSPFKADEMFDPXEVFNFPERGPRGPLGVETFLDSGPKAEGGIGDNKGGPYAVTYVPPT
GGMYTLTMKYGGELVPHFPSHVKVEPAVDTSRVKVFGPGIEGKDVFREATTDFTVDSRPL
TQVGGDHIKAHISNPSGASTECFVTDNADGTYQVEYTPFEKGLHVWDVTYDDVPVPNSPF
KVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDN
KDGSCSAEYVPFAPGDYDVNITYGGSHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRAH
ILQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYA
DEEIPRSPFKVKVLPTYDASKVTASGPGLSTYGVPASLPVEFAIDARDAGEGLLAVQITD
QEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCL
ATGPGIASTVKTGEEVGFVVDAKTAGKGKETCTVLTPDGTEAEADVIENEDGTYEIFNTA
NKPGTYVIYMRFGGINIPNTPLTVMATDGEVAVMEEAPVNACSPGFRPWVTEEAYVPVSD
MNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEM
HIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAI
EGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQV
KLGSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFPREVGEHLVSIK
KNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAV
EGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESI
TRTSRAPSVATVGSICDLNLKIPEIDSSDMSAHVTSPSGRVTEAEIVPVGKNSHCVRFVP
QEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHVRAGGPGERGERVPAEFSIWTREAG
AGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYYVSIKFNYKHIPXXXXXXXXXX
XXDARRLTVLSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKY
AVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLEGGTTGIQS
EFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLIGVKYGGPNHIV
GSPFKAKVTGQRLVSPGLANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLS
KAFVGQKSSFLVDCSKAGSMLLIGVGPTTCEEVSMKHVGNQQYNVTYVVKEKGDYVLAVK
WGEEHIPGSPFHVTVP
Download sequence
Identical sequences ENSVPAP00000000859 ENSVPAP00000000859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]