SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001005 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001005
Domain Number 1 Region: 48-157
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000361
Family Growth factor receptor domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001005   Gene: ENSVPAG00000001083   Transcript: ENSVPAT00000001090
Sequence length 996
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3523:63913:111896:1 gene:ENSVPAG00000001083 transcript:ENSVPAT00000001090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTGCRGAWVAMAAWFAFSIATATVFLLLVLSRVSQAQAFFFPFRQPETCGHNEYFDISA
LSCVPCGANQRQDARGTSCVCLPGFQMISNNGGPNIICKKCPENMKGVTEDGWNCISCPA
GLTAEGKCHCPTGHILVERDVNGTLLPQATCKLCDGSENSFMVANALGNXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVSFTSEWFAKYLQSSAAACWV
YANLTSCQALGNMCVMNMNSYDSSTFDACRLFQFIFENTAGLRTVHSFSFWRQNLPWLFY
GDQLGLAPQVLSTTPLPTNFSFKGQNQNTKLKFVAASYDVRGNFLKWQTLEGGVLQLCPD
TETRLNAAYSFGTTYQQSCEIPISKLLTDFPTPVFYDVYLEYTGENQHRYIWAVPVLNLN
LQHNKIFVNQDSSSGKWLLTRRIFLVDALSGRENDLESQPRLVRVATQISLSIHLVPNTK
NGNIYPPLITIAYSDVDVRDPTSQSVEVSFSVRYEMDQGEAHVQTDIALGVLGGLAVLSS
LLKTAGWKRRVGSPMIDLQTVVKFLVYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVL
LPVPAQEERFVTFVGCAFALKALQFLHKLISQITIDIFFIDWERPKGKVLKAVEGEGGVR
SATVPVSIWRTYFVANEWNEIQTVRKINPLFQVLTVLFFLEVVGFKNLALMDSSSSLSRS
PSSYIAPYSRILRYAVSAAAWLVIALMQIVFFVVFYERFIEDKIRQFVDLCCMSNISVFL
LSHKCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFQIAISSQM
RQHYDRIHETLTRRNGPARLLSSPASTFEQSIKAYHTMNKFLGSFIDHVHKEMDYFIKDK
LLLERILGMEFMEPVEKSIFYNDEGYSFSSVLYYGNEATLLIYDLLFFCVVDLACQNFIL
AACLTYLQQEIFRFIRNTVGQKNLASKTLVDQRFLI
Download sequence
Identical sequences ENSVPAP00000001005 ENSVPAP00000001005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]