SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001036 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001036
Domain Number 1 Region: 16-119
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 9.16e-19
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001036   Gene: ENSVPAG00000001122   Transcript: ENSVPAT00000001122
Sequence length 119
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1687:186591:216099:1 gene:ENSVPAG00000001122 transcript:ENSVPAT00000001122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKPKATCSAAAPLEERRFRVLVGVTGSVAALKLPLLVSRLLDIPGXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXLWKCRSDPVLHIDLRRWADLMLVAPLDANTGKVASGICDNLL
Download sequence
Identical sequences ENSVPAP00000001036 ENSVPAP00000001036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]