SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001302 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001302
Domain Number 1 Region: 1200-1486
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.82e-53
Family Tandem AAA-ATPase domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1495-1704
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.75e-47
Family Tandem AAA-ATPase domain 0.00099
Further Details:      
 
Domain Number 3 Region: 481-651,680-734,772-868
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.47e-43
Family Tandem AAA-ATPase domain 0.00087
Further Details:      
 
Domain Number 4 Region: 1834-2016
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 3.92e-42
Family Sec63 N-terminal domain 0.0000971
Further Details:      
 
Domain Number 5 Region: 1004-1162
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 4.71e-28
Family Sec63 N-terminal domain 0.0068
Further Details:      
 
Domain Number 6 Region: 2052-2160
Classification Level Classification E-value
Superfamily E set domains 3.36e-22
Family Sec63 C-terminal domain-like 0.00059
Further Details:      
 
Domain Number 7 Region: 1704-1780
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000735
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.078
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000001302
Domain Number - Region: 882-987
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0272
Family Hypothetical protein PH1932 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001302   Gene: ENSVPAG00000001408   Transcript: ENSVPAT00000001409
Sequence length 2181
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_886:1382076:1707797:-1 gene:ENSVPAG00000001408 transcript:ENSVPAT00000001409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPRLTGALRSFSNVTKQDNYNEEVADLQMKRSKLHEQIVGLDLTWKKIVKFLNEKLEK
SEMQSVNEDLKDLLQAAKQIVGMDHGKEAIESAAAFLFKTFHLRDSVGHKETKAIKQMFG
PFPSSSATAACNATNRITSHFCKDSLTALVQMTTDECDDRILFGKNLAFSFDMHDLDHFD
ELPINGESQKTISLDYKKFLADHFQEHSTPDLKPVEKTNDSFLWCEVEKYLNATLSEMAE
ATRVEDLCCTLYDMLASVKSGDELQDELFELLGPDGLELIEKLLQNRITIVDKFLNSSND
HKLQALQDNCKKILGENAKPNYGCQVTIQSEQEKQLMQYRREEKRIARREKKAGEDGEIA
EGCFDPKELRIHREQALMNARSVPVLSRQRDTDVEKIRYPHVYDSQAEAMKTSAFIAGAK
MILPEGIERENNKMYEEVKIPYSEPMPVGFQEKPVYIQDLDEIGQLAFKGMRRLNRIQSI
VFETAYNTNENMLICAPTGAGKTNIAMLTVLHEIRQHFQQGVIKKNEFKIVYVAPMKALA
AEMTNYFSKRLEPLGIVVKELTGDMQLSKNEILRTQMLVTTPEKWDVVTRKSVGDVALSQ
IVKLLILDEVHLLHEDRGPVLESIVARTLRQVESTQSMIRILGLSATLPNYLDVATFLHV
NPCIGLFYFDGHFRPVPLGQTFLGVKSANKVQQLNNMDEVCYESVLKQVKAGHQVMVFVH
ARNATVRTAVSLIERAKNNGQISYFLPTQGPEYGHAEKQVQKSRNKQVRELFPDGFSIHH
AGMLRQDRNLVESLFSNGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYAAKRGSFVDLGI
LDVMQIFGRAGRPQFDKFGEGIIITTHDKLSHYLTLLTQQNPIESQFLESLADNLNAEXX
XXXXXXXXXAVKWISYTYLYVRMRANPLVYGISHKAYQIDPTLAKHREQLVIEVGRKLDK
ARMIRFEERTGYFSSTDLGRTASHYYIKYSTIETFNELFDAHKTESDIFAIVSKAEEFDQ
IKVREEEIEELDALLNNFCELSAPGGVENSYGKINILLQTYISRGEMDSFSLISDSAYVA
QNAARIVRCGILESTCRHASLSIXXKLQCGGIPVLPPHILTRLEEKNLTVDKLKDMRKDE
IGHILHHVNIGLKVKQCVHQIPSVTMEASIQPITRTVLRVTLSICPDFTWNDQVHGTVGE
PWWIWVEDPTNDHIYHSEYFLVLKKQVISKEAQLLVFTIPIFEPLPSQYYIRAVSDRWLG
AEAVCIINFQHLILPERHPPHTELLDLQPLPITALGCEAYEALYNFSHFNPVQTQIFHTL
YHTDCNVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIAPLKALVRERMDDWKVRIEE
KLGKKVIELTGDVTPDMKSIAKADLIVTTPEKWDGISRSWQNRNYVKQVTILIIDEIHLL
GEERGPVLEVIVSRTNFISSHTEKPVRIVGLSTALANARDLADWLNIRQMGLFNFRPSVR
PVPLEVHIQGFPGQHYCPRMASMNKPTFQAIRSHSPAKPVLIFVSSRRQTRLTALELIAF
LATEEDPKQWLNMDEREMENIIGTVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNC
KVQVLIATSTLAWGVNFPAHLVIIKGTEYYDGKTRRYVDFPITDVLQMMGRAGRPQFDDQ
GKAVILVHDIKKDFYKKFLYEPFPVESSLLGVLSDHLNAEIAGGTITSKQDAMDYITWTY
FFRRLIMNPSYYNLSDVSHDSVNKFLSSLVEKSLVELEHSYCIEIGEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDAEEYTDLPVRHNEDHMNSELAKCLPFE
SNPHSFDSPHTKAHLLLQAHLSRAMLPCPDYDTDTKTVLDQALRVCQAMLDVAAHQGWLV
TVLNITNLVQMVIQGRWLKDSSLLTIPHIENHHLHIFRKWSSGIKGPHAGFHGFIECLPE
LIHACGGKDHIFSSMIEKELPAPKLKQAWNFLSHLPVIDIGLSVKGWWDDSEEGHDELPI
TTVTSDKRSDNKWVKLHADQEYVLQVSLQRVSTGFHKGKQDSHAVAPRFPKSKDEGWFLI
LGEVDKKELIALKRVGYVRNHHVVSISFYTPEVYIYTLYFMSDCYLGLDQQYDIHLHVTP
ASVSAQADEELSDALTDLQVK
Download sequence
Identical sequences ENSVPAP00000001302 ENSVPAP00000001302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]