SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001464 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001464
Domain Number 1 Region: 85-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.09e-32
Family Skp1 dimerisation domain-like 0.00000653
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily POZ domain 1.31e-25
Family BTB/POZ domain 0.0000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001464   Gene: ENSVPAG00000001583   Transcript: ENSVPAT00000001583
Sequence length 164
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_919:93410:101944:-1 gene:ENSVPAG00000001583 transcript:ENSVPAT00000001583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEKG
Download sequence
Identical sequences ENSVPAP00000001464 ENSVPAP00000001464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]