SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001577 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000001577
Domain Number - Region: 12-77
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000218
Family I set domains 0.054
Further Details:      
 
Domain Number - Region: 228-288
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0596
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001577   Gene: ENSVPAG00000001707   Transcript: ENSVPAT00000001707
Sequence length 290
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1735:325889:330096:1 gene:ENSVPAG00000001707 transcript:ENSVPAT00000001707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLYVELHHNSPVLLCTDFKRAQKETVDPTYLWIGPNEKPLTGTSRINITKTGKLLVKDFL
EPLSGLYTCTLSYKIVKAETQEEKTVKQRYDFMLFXXREPDYAYQAVRTTNLCEKYNDLF
KVLKKILNNLISDLSCHIIEPSYKCHFVKIPKHGLTHELFIAFQVNPFAPRWKGTCNESV
DCEDTTNHNILQARNRIEEFFRRQAYIFKHDFKKTLPAMHFVDHSFHIMRMDSCRPGFGK
NEGLHSNCASCCVVCSPGTFSPDVDVTCQTCVSTRIYGAKTCPTKNQCED
Download sequence
Identical sequences ENSVPAP00000001577 ENSVPAP00000001577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]