SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001596 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001596
Domain Number 1 Region: 260-343
Classification Level Classification E-value
Superfamily E set domains 5.88e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001596   Gene: ENSVPAG00000001729   Transcript: ENSVPAT00000001729
Sequence length 589
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2423:259752:725162:-1 gene:ENSVPAG00000001729 transcript:ENSVPAT00000001729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI
RTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCKVLFTEHLMMPRCLFKEICVRNANCGHLF
LHRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGR
RARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWS
ELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKV
IPRHPGDPERLPKXXXFKRAADLVGSSYGMAHNNQEIILKRAADIAEALYSVPRNHSQLP
ALTNTSVHAGMMGVNSFSGQLAVNVSEASQATNQXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISGMIVPPM
Download sequence
Identical sequences ENSVPAP00000001596 ENSVPAP00000001596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]