SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001601 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001601
Domain Number 1 Region: 140-442
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.29e-112
Family Transglutaminase core 0.000000000145
Further Details:      
 
Domain Number 2 Region: 2-137
Classification Level Classification E-value
Superfamily E set domains 3.5e-43
Family Transglutaminase N-terminal domain 0.00000943
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001601   Gene: ENSVPAG00000001735   Transcript: ENSVPAT00000001735
Sequence length 442
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1205:6335:115687:1 gene:ENSVPAG00000001735 transcript:ENSVPAT00000001735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LELQNINWQTASNRQAHHTNKFYSRDLIVRRGQPFYISLKFNQNLGSGASLTFIASTGPY
PSESAKTKAVFPLSSGTRSSGWGAQLVSNENKVLNISILSPANAPIGRYTLGIQISAQGS
ASTQNLGTFILLFNPWLQADAVFMNNQAEREEYVQEDSGIIFVGSANRIGMIGWNFGQXX
XXILNICLAVLDNSLNFRRDRATDVAHRSDPKYVGRVLSAMINGNDDNGVISGNWSGSYP
GGRDPRNWNGSVEILKEWQRSGFRPVRYGQCWVFAGTLNTVLRSFGIPSRVITNFNSAHD
TDRNLSVDVYYDPMGRPMDKGSDSVWNFHVWNEAWFVRTDLGPSYNGWQVLDATPQERSQ
GVFQCGPASVIALREGNVDWDFDMPFIFAEVNADRITWIYNASNGTMKKNSSDSHTVGRY
ISTKAVGSNSRMDVTEKYKYPE
Download sequence
Identical sequences ENSVPAP00000001601 ENSVPAP00000001601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]