SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001602 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001602
Domain Number 1 Region: 329-460
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.86e-49
Family Transglutaminase core 0.00000695
Further Details:      
 
Domain Number 2 Region: 495-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.76e-25
Family Transglutaminase, two C-terminal domains 0.00027
Further Details:      
 
Domain Number 3 Region: 608-703
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.88e-24
Family Transglutaminase, two C-terminal domains 0.00015
Further Details:      
 
Domain Number 4 Region: 3-60
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000455
Family Transglutaminase N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001602   Gene: ENSVPAG00000001736   Transcript: ENSVPAT00000001736
Sequence length 706
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1205:194865:277902:1 gene:ENSVPAG00000001736 transcript:ENSVPAT00000001736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIRVTEVDWQQPRNGTAHHTEEYPGPVLVVRRGQRFTFTLKMNKPLESEETLVFTVET
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXHQADPATDVSRRHDPIYVTRAISAMXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNFHVWNESWFARQDLGPCYKGWQVLDVTPQ
EESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYVTWLWNEDESRERVYSDTKKI
GRCISTKAVGSDSRVDITSLYKYPEGSRKERQVYSKAVKKLFSMEVSGRRTRVHRAGGRG
LWRDDLLEPATKPCITGKFKVLEPLVLGHDLKLALCLGNLTYRAQQVQVNLSGATILYTR
RPVAEILHESHAVKLEPQEEKNIPIAICYSQYKKDLTEDKKILLAAMCLVTRGEKLLVEK
DITLEEFITIKVLGPAVVGVAVTVEVMVVNPLSERVENCMLTVEGSGLLQGQLSINVPSL
EPQEKASVQFNITPSRSGPRQLQVDLVGPHFPDIKGFVIIHVATAN
Download sequence
Identical sequences ENSVPAP00000001602 ENSVPAP00000001602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]