SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001609 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001609
Domain Number 1 Region: 401-695
Classification Level Classification E-value
Superfamily SIS domain 1.59e-75
Family double-SIS domain 0.0000038
Further Details:      
 
Domain Number 2 Region: 115-209,264-308
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.26e-25
Family Class II glutamine amidotransferases 0.00059
Further Details:      
 
Domain Number 3 Region: 1-69
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.0000463
Family Class II glutamine amidotransferases 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001609   Gene: ENSVPAG00000001743   Transcript: ENSVPAT00000001743
Sequence length 696
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3130:562437:603036:-1 gene:ENSVPAG00000001743 transcript:ENSVPAT00000001743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGVDGGNDKDWEANACKIQLIKKK
GKVKALDEEVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIVIHN
GIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRESQDTSFTTLVERVIQQLEG
AFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTARTQIGSKFTRWGSQ
GERGKDKKGSCNLSRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVV
DGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRQVLEELTELPVMVELASDFL
DRNTPVFRDDVCFFISQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHIN
AGPEIGVASTKAYTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLIKEVLSMDD
EIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDK
LMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQ
GILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVK
Download sequence
Identical sequences ENSVPAP00000001609 ENSVPAP00000001609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]