SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001840 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000001840
Domain Number - Region: 88-176
Classification Level Classification E-value
Superfamily SIS domain 0.03
Family mono-SIS domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001840   Gene: ENSVPAG00000001993   Transcript: ENSVPAT00000001993
Sequence length 349
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2392:230396:239542:1 gene:ENSVPAG00000001993 transcript:ENSVPAT00000001993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHGIETPEPGKWEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXPTYQRLYSESTLTTMVVAGKVQEALEPGGEAVLSGGGTSGRMAFFMSVSFNQ
LMKGLGQKPLYTPLIARGNRSMVASREGTEDSALDGTEKLKKVAAGKKRVTIIGISVRLY
APFVAGQIDDCMDNPAVFLPVPIGFNPVSMARSDPIEGWSSTFQQIAEQIQKVQEQVAFM
LSPANGPEGLNGSSQMKGGSATKILLKTLLLAAHKTVDCGIIASQRCLLEILRTFEAYVT
YSQSPKIATLMKQASTSLEKKGQGYLAGWQTLGIIAIIDVIECIHTFGA
Download sequence
Identical sequences ENSVPAP00000001840 ENSVPAP00000001840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]