SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001880 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001880
Domain Number 1 Region: 6-93
Classification Level Classification E-value
Superfamily E set domains 3.36e-17
Family Other IPT/TIG domains 0.00000934
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001880   Gene: ENSVPAG00000002036   Transcript: ENSVPAT00000002036
Sequence length 707
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_899:3497:63280:-1 gene:ENSVPAG00000002036 transcript:ENSVPAT00000002036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLLGLTICGHNCLLTAEWISASKI
VCRVGRAENDRGDIIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVEEMSYYDVRTDR
SKGAPPLSLRPANPLGIEIQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHQKLEADGTERVGGSMTQ
RLEDVLNRASNTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
VVINDYEKAKSLFGKTEVQVFKKYYAEVEMRIEALRELLLDKLLETPSTLHDQKRYIXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPGLHGAALELDGDSRPSVLGH
LGQTASLKRGSSSQPGRDDTWRDRTPHRVAFVEKLTKLVLSQLPNFWKLWVSYVTGSLFS
EXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKR
LPEKEDWVVDSEGLTSLPCQFERCVVHTLQSLRGVLECKPGEASVFQEPRTQEEVCQLST
NIVQXXXXXXXXXXXXXXXXXXXXXLSTDVSSPDLFGSIHEDFTLTS
Download sequence
Identical sequences ENSVPAP00000001880 ENSVPAP00000001880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]