SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001900 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001900
Domain Number 1 Region: 249-331
Classification Level Classification E-value
Superfamily E set domains 2.8e-21
Family Cytoplasmic domain of inward rectifier potassium channel 0.00052
Further Details:      
 
Domain Number 2 Region: 48-189
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.43e-20
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001900   Gene: ENSVPAG00000002058   Transcript: ENSVPAT00000002058
Sequence length 368
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3413:376619:378040:1 gene:ENSVPAG00000002058 transcript:ENSVPAT00000002058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAINVGMSSPPLVKPTMGAGLKTSRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPSGHSSNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHVD
SSSESLLPMFYHVLDETSPLRLTPQLKEKEELVVLLNATVESTSAVCQSRTSYIPEEIYW
GFEFVPVVSLSKNGKYVADFSQFEQIRKSSNCISYCADSEKQKLEEKYRQEDQRERELRT
LLLQQSNV
Download sequence
Identical sequences ENSVPAP00000001900 ENSVPAP00000001900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]