SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001917 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001917
Domain Number 1 Region: 406-673,800-821
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5e-44
Family FAD-linked reductases, N-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 270-376
Classification Level Classification E-value
Superfamily Homeodomain-like 3.49e-20
Family SWIRM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000001917
Domain Number - Region: 61-105
Classification Level Classification E-value
Superfamily RING/U-box 0.0226
Family RING finger domain, C3HC4 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001917   Gene: ENSVPAG00000002075   Transcript: ENSVPAT00000002075
Sequence length 822
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_883:561387:610548:1 gene:ENSVPAG00000002075 transcript:ENSVPAT00000002075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPRGRTKKKASFDHSPDSLPLRSSGRQAKKKATETTDEDEDGGSEKKYRKCEKAGCTA
TCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSN
GKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNSAVKPE
TSDHCSLPEDLRVSEVSNHWWYSMLILPPLMKDSVAAPLLSAYYPDCVGMSPSCTSTHRV
ASDASPGKLEHAKAVPSVLVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPEYSR
DPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLI
NTGVLSVGTDQPLLPKDYHNXXXXXXXXXXXXXXXXXXXXXXXXXVTVLEAKDRIGGRVW
DDKSFKGVTVGRGAQIVNGCINNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTIDKR
MDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEEQVLQFHLSN
LEYACGSSLHQVSACSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIRLRSPQVQSI
DYSGDEVQVTTTDGSGWTTQKVLVTVPLALLQKGAIQFNPPLSDKKMKAINSLGAGIIEK
IALQFPYRFWDSKVQGADFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXATNRHFPQTVTGAYLSGVREASKIAAFI
Download sequence
Identical sequences ENSVPAP00000001917 ENSVPAP00000001917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]