SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001926 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001926
Domain Number 1 Region: 380-471
Classification Level Classification E-value
Superfamily Integrin domains 4.29e-21
Family Integrin domains 0.0023
Further Details:      
 
Domain Number 2 Region: 193-266
Classification Level Classification E-value
Superfamily vWA-like 5.56e-18
Family Integrin A (or I) domain 0.00025
Further Details:      
 
Domain Number 3 Region: 44-102
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000199
Family Plexin repeat 0.00073
Further Details:      
 
Domain Number 4 Region: 319-385
Classification Level Classification E-value
Superfamily vWA-like 0.00000000218
Family Integrin A (or I) domain 0.0012
Further Details:      
 
Domain Number 5 Region: 589-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000149
Family Integrin beta EGF-like domains 0.0066
Further Details:      
 
Domain Number 6 Region: 545-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000001926
Domain Number - Region: 509-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000893
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001926   Gene: ENSVPAG00000002085   Transcript: ENSVPAT00000002085
Sequence length 765
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1891:1001631:1082846:1 gene:ENSVPAG00000002085 transcript:ENSVPAT00000002085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRSTLAFFTATFVCLQNCRPGPAPFLRAAWMFSVVLGLGQSEDNRCASSNAVSCTKCLA
LGPECGWCAQEDFISGGSRNERCDILSNLINKGCSIDSIEYPSVHVIPSENEINTQVTPG
EVLIQLRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAV
HRQKISGNIDTPEGGFDAMLQAAVCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGT
IAGEIESKAANLNNLVVEAYQKLISEVRVQVEQVKGVYFNITAICPDGTKKPGTDGCGNV
TSNDEVLFNVTVTMEKCNVTGGKSYAIIKPIGFNETTKLHIHRNCSCQCDDSRGPKRKCV
EETFLDAKCFQCDENNCHFDEDQSPSESCKSHKDQPVCSGRGVCICGKCLCHKIKLGKVY
GKYCEKDDFSCPYHHGNLCAGHGECEAGKCQCFRGWEGDRCQCPSASAQYCVNPKGQVCS
GRGTCVCGRCECTDPRSIGRFCEHCPTCHTACNENWNCVQCLHPHNLSQAIVDRCKTSCA
LKEHYVDQTPECFSSPSYLRIFFIIFIITFLIGLLKVLIIRQVILQWNSNKIKSSADYRV
SASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNY
Download sequence
Identical sequences ENSVPAP00000001926 ENSVPAP00000001926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]