SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001957 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001957
Domain Number 1 Region: 961-1128
Classification Level Classification E-value
Superfamily C-type lectin-like 4.55e-44
Family C-type lectin domain 0.00000614
Further Details:      
 
Domain Number 2 Region: 1129-1189
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000612
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 925-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000292
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 4 Region: 7-71
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000995
Family I set domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001957   Gene: ENSVPAG00000002120   Transcript: ENSVPAT00000002120
Sequence length 1235
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3586:25996:93509:1 gene:ENSVPAG00000002120 transcript:ENSVPAT00000002120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQDLPILVAKDNVVREAKGWQGRVSLPAYPRHRANATLLLGPLKASDSGLYRCQVVRGIE
DEQDLVPLEVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHPTSQHGDPETPSSGDEGEILSAEGPPA
QELEPSLGEEEVVTPDFQEPLMSSGEEEPLILAEKQESQETPSLAPGRPTLASVPALEAE
EEWLSTVAPSPSTVEAGTAVGMHTEATPASIMPRRRGRFKGLNGRHFQQQEPQRGLKGGL
EASIQTPTPEVAGNYVEPPLATGATDALGSGRSQSPWAVLTNEVDVPGDGSPGGRTPTES
WLWPPTMVPPIIPDPSRALDLELEEAKGPSVRPAILDLPWSASEATGSAPSPAPWEASPM
VISPDLPVMAMLRAPKLWLLSHPTSLPTTTGVKEYSEAMVAAPPSPDSDSETKMYSLPSS
GLTGQGGEATSPTPNSPETDFRKTEGTSPTGLSKAECPRTSPQTSVDGNVVPDSTPTEPA
SEPVGARGISGSESGVFSTAENPTSSFQATMDEVQDTLSSLHSEGLDPHPSSAPSGGPGV
SLMPKVTSSLEPWAAVDGRAPVGSMDTTATLDPSDAGGIWEPGSYVVEGAESLTVSPQVA
VDTSVVTSRMSQDLGGKVGVLPMATMASSSSQPHPEPEGQVVTQETPGALAPLADGSPPR
EPALPLWTPTAASLDEPISVSSGESTMPWDSSSTQLPXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXPLDPCENNPCLHGGTCEANGTMYGCSCDQGFTGENCE
IDIDDCISSPCENGGTCIDEVNAFVCLCLPSYAGSLCEKDTEGCDHGWHKFQGHCYRYFA
HRRAWEDAERDCRRRAGHLTSIHSPEEHGFINSFGRENTWIGLNHRIVERDFQWTDNTGL
QYENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPCNYNLPYVCKKGTVLCGPPPAVENA
SPIGARKAKYNVHATVRYQCDEGFAQHHVATIRCRSNGKWDRPQIVCTKPRRSHRMRRHH
HHHHHQHRHHKSRKERRKHKKHPAEDWEKEEGNFC
Download sequence
Identical sequences ENSVPAP00000001957 ENSVPAP00000001957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]