SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002170 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002170
Domain Number 1 Region: 178-576,657-662,693-726
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.07e-93
Family FAD-linked reductases, N-terminal domain 0.000000000000996
Further Details:      
 
Domain Number 2 Region: 561-669
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.85e-30
Family L-aminoacid/polyamine oxidase 0.00000141
Further Details:      
 
Domain Number 3 Region: 74-179
Classification Level Classification E-value
Superfamily Homeodomain-like 5.64e-27
Family SWIRM domain 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002170   Gene: ENSVPAG00000002347   Transcript: ENSVPAT00000002347
Sequence length 727
Comment pep:known_by_projection scaffold:vicPac1:scaffold_4721:1645:47721:-1 gene:ENSVPAG00000002347 transcript:ENSVPAT00000002347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGG
LQDDSSGGYGDGQASGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRT
QLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKT
GKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLG
GNPMAVVSKQVNMELAKIKQKCPLYEANGQADTVKVPKEKDEMVEQEFNRLLEATSYLSH
QLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEK
IKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEAN
PPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCV
PVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQP
PAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLF
WXXXXXPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAAPQPKETVVSRWRAD
PWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGA
LLSGLRE
Download sequence
Identical sequences ENSVPAP00000002170 ENSVPAP00000002170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]