SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002374 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002374
Domain Number 1 Region: 255-355
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.79e-20
Family AlaX-like 0.015
Further Details:      
 
Domain Number 2 Region: 2-100
Classification Level Classification E-value
Superfamily HSP20-like chaperones 4.19e-20
Family Co-chaperone p23-like 0.00029
Further Details:      
 
Domain Number 3 Region: 149-173
Classification Level Classification E-value
Superfamily Translation proteins 0.0000812
Family AlaX-M N-terminal domain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002374   Gene: ENSVPAG00000002571   Transcript: ENSVPAT00000002571
Sequence length 522
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1328:37967:55100:-1 gene:ENSVPAG00000002571 transcript:ENSVPAT00000002571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFCVEDSTDVHALLEDHRIVFSCKNPDGVELYNEIEFYAKVNSKDSQDKRSGRSITCFV
RKWKENVAWPRLTKEDIKPVWLSVDLDNWRDEGDEEVELAEHYAELLKKVSTKKPPPAMD
DLDFTTTVVSCRPAELQTEGSNGKKEVLSGFQVVLEDTLLFPEGGGQPDDHGXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
ELGRLRSVIELDGPLVTAEQVAAIEQDVNEKIRDRLPVNVRELSLDDPEVEQVRGRGLPE
DHAGPIRVVTIKGVDSNMCCGTHVNNLSDLQVIKILGTEKGKKNKTNLIFLAGNRVLKWM
ERSHGTEKALSALLKCGAEDHVEAVKKLQNSTKLLQKNNLNLLRDLAVHIAHSLRNSPDW
GGVVTLHRKEGDSEFMNIIANEIGSEETLLFLTVGDERGAGLFLLVGPAEAVETLGPRVA
EVLEGKGAGKKGRFQGKATNMSRRAEVQALLQDFVSTQSAEE
Download sequence
Identical sequences ENSVPAP00000002374 ENSVPAP00000002374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]