SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002384 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002384
Domain Number 1 Region: 387-562
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.55e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000109
Further Details:      
 
Domain Number 2 Region: 564-664
Classification Level Classification E-value
Superfamily E set domains 7.24e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002384   Gene: ENSVPAG00000002581   Transcript: ENSVPAT00000002581
Sequence length 1000
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2573:95666:144136:1 gene:ENSVPAG00000002581 transcript:ENSVPAT00000002581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEPDDCASIYIFNVDPPPSTLNSPLCLPHHGLPSHSSVLSPPYPLQGHKSYEGTCEIPES
KYSPLGGPKLFECPSIQITSISPNCHQEIDAHEDDLHINDPEREYLERPSRDHLYLPLEP
SYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGS
PGGCPGEESWHQQYGLGYSLSPRQSPCHSPRSSITDENWLSPRPASGPSSRPTSPCGKRR
HSSAEVCYAGSLSPHHSPVPSPGHSPRGSVTEDTWLSASVQGGSGLGPALFPFQYCVETD
IPLKTRKTSEDQATIVPGKLELCSDDQGNLSPSRETSIDDGLGSQYPLKKDSSGDQFLSV
PSPFTWSKPKPGHTPIFRTSSLPPLDWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGA
VKASTGGHPVVKLLGYSEKPINLQMFIGTADDRYLRPHAFYQVHRITGKTVATASQEIII
ASTKVLEIPLLPENNMSASIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQP
NGKVLSLQTASIPVECSQRSAQELPHIEKYSINSCSVTGGHEMIVTGSNFLPESKIIFLE
KGQDGRPQWEVEGKIIKEKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRF
TYTPVLMKQEHREEIDLSSVPSLPMPHPAQTKRPSSDTGHLHDSVLSAQRSLVCPIQQTY
ASMVTSSHLPQLLCRDESAGKEQHMIPSSVLHQPFQVTPTPPVGSSYQPMQTNVVFNGPT
CLPVNAASSQEFDPVLFQQDAVLPTLVNLGCQPPSSIPFHSSNSGSTGHLLAHTPQSVQT
LPHLQSMGYHCSNTGQRSLSSPVADQVTSQPSPQLQPITYGPSHSGSATAASPAASHPLA
SSPLSGPPSPQLQSMPYQSPSSGTASSPSLATRMHSGQHSTQAQNTGQGGLSAPSSLLCH
NLCDPASFPPDETSVNIKPEPEEQEPNFSTIGLQDITLDD
Download sequence
Identical sequences ENSVPAP00000002384 ENSVPAP00000002384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]